PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0056000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 187aa    MW: 21354.5 Da    PI: 10.6059
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0056000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK86.91.7e-271362352
          RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                    ++i+l +lskyF+ pi++A+++L+v++TvLKr+CR++GI+RWPhRkiksl
  Spipo1G0056000 13 SNITLAELSKYFEVPIAEASRHLNVGQTVLKRKCREFGIPRWPHRKIKSL 62
                    69**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.917182IPR003035RWP-RK domain
PfamPF020424.6E-231462IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MKQNKRATIE DISNITLAEL SKYFEVPIAE ASRHLNVGQT VLKRKCREFG IPRWPHRKIK  60
SLDTLIQDLQ VVVEERRGQD ESAAAAEKQR LLEMEKQSIK KDPVMDLQSE TKRFRQDIFK  120
RRHRLKALVQ QGTDGSAMGD DLLYFVRSVN SPAAAAAARR EDDQRNHLKG RPQKENPPRV  180
MTPALS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009413171.12e-51PREDICTED: protein RKD5
SwissprotO817911e-41RKD5_ARATH; Protein RKD5
TrEMBLA0A067LHU74e-50A0A067LHU7_JATCU; Uncharacterized protein
STRINGVIT_04s0044g00060.t013e-49(Vitis vinifera)
STRINGGLYMA01G36360.12e-48(Glycine max)
STRINGGSMUA_Achr8P13370_0014e-48(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-42RWP-RK domain-containing protein